Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d023689_circ_g.4 |
ID in PlantcircBase | zma_circ_010168 |
Alias | zma_circ_0000114, GRMZM5G862959_C1 |
Organism | Zea mays |
Position | chr10: 15556755-15557491 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d023689 |
Parent gene annotation |
SGF29 tudor-like domain |
Parent gene strand | + |
Alternative splicing | Zm00001d023689_circ_g.2 Zm00001d023689_circ_g.3 Zm00001d023689_circ_g.5 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d023689_T001:2 Zm00001d023689_T002:2 Zm00001d023689_T006:2 Zm00001d023689_T003:1 Zm00001d023689_T004:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.161211982 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15556815-15556812(-) |
Potential amino acid sequence |
MTFTTNHSSFSSSDFTLAATFECSLRHHLVLHQVLHTLLFPYRNV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |