Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0466100_circ_g.1 |
ID in PlantcircBase | osa_circ_024119 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 23308708-23309008 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0466100 |
Parent gene annotation |
Similar to Cell division protein FtsH-like protein. (Os04t046610 0-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0466100-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005541* osi_circ_014442 |
PMCS | 0.412618383 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23308960-23308720(+) 23308998-23309000(-) |
Potential amino acid sequence |
MTITFMSESKPSISVSSPSSS*(+) MDGFDSDMKVIVMAATNRPKALDPALCRPGRFSRKVLVGVPDLEGRRNILAVHLRDVPLEEDPE IICDLVASLTPGLVGADLANIVNEAALLAARRAAY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |