Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0466100_circ_g.1 |
| ID in PlantcircBase | osa_circ_024119 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 23308708-23309008 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0466100 |
| Parent gene annotation |
Similar to Cell division protein FtsH-like protein. (Os04t046610 0-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0466100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_005541* osi_circ_014442 |
| PMCS | 0.412618383 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23308960-23308720(+) 23308998-23309000(-) |
| Potential amino acid sequence |
MTITFMSESKPSISVSSPSSS*(+) MDGFDSDMKVIVMAATNRPKALDPALCRPGRFSRKVLVGVPDLEGRRNILAVHLRDVPLEEDPE IICDLVASLTPGLVGADLANIVNEAALLAARRAAY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |