Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d005257_circ_g.12 |
ID in PlantcircBase | zma_circ_007305 |
Alias | zma_circ_0000835, GRMZM2G068212_C8 |
Organism | Zea mays |
Position | chr2: 166052108-166054817 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d005257 |
Parent gene annotation |
Sulfate transporter 4.1 chloroplastic |
Parent gene strand | - |
Alternative splicing | Zm00001d005257_circ_g.1 Zm00001d005257_circ_g.2 Zm00001d005257_circ_g.3 Zm00001d005257_circ_g.4 Zm00001d005257_circ_g.5 Zm00001d005257_circ_g.6 Zm00001d005257_circ_g.7 Zm00001d005257_circ_g.8 Zm00001d005257_circ_g.9 Zm00001d005257_circ_g.10 Zm00001d005257_circ_g.11 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d005257_T005:1 Zm00001d005257_T006:3 Zm00001d005257_T004:2 Zm00001d005257_T007:2 Zm00001d005257_T002:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.042969071 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
166052298-166054465(-) 166052114-166054614(-) |
Potential amino acid sequence |
MFYFVYRLGWLIRFISHSVISGFTTASAIVIGLSQIKYFLGYNVTRSSKIIPLIESIIAGADEA MSYAKLAGLHPIYGLYTGFVPLFIYAIFGSSRQLAVGPVALVSLLVSNVLGGIVNSSSKLYTEL AILLAFMVGILECLMGLLR*(-) MRQCHMQSWLGCTQFMGSTQALSRYLYMQYLARHDN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |