Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d005257_circ_g.12 |
| ID in PlantcircBase | zma_circ_007305 |
| Alias | zma_circ_0000835, GRMZM2G068212_C8 |
| Organism | Zea mays |
| Position | chr2: 166052108-166054817 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d005257 |
| Parent gene annotation |
Sulfate transporter 4.1 chloroplastic |
| Parent gene strand | - |
| Alternative splicing | Zm00001d005257_circ_g.1 Zm00001d005257_circ_g.2 Zm00001d005257_circ_g.3 Zm00001d005257_circ_g.4 Zm00001d005257_circ_g.5 Zm00001d005257_circ_g.6 Zm00001d005257_circ_g.7 Zm00001d005257_circ_g.8 Zm00001d005257_circ_g.9 Zm00001d005257_circ_g.10 Zm00001d005257_circ_g.11 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d005257_T005:1 Zm00001d005257_T006:3 Zm00001d005257_T004:2 Zm00001d005257_T007:2 Zm00001d005257_T002:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.042969071 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
166052298-166054465(-) 166052114-166054614(-) |
| Potential amino acid sequence |
MFYFVYRLGWLIRFISHSVISGFTTASAIVIGLSQIKYFLGYNVTRSSKIIPLIESIIAGADEA MSYAKLAGLHPIYGLYTGFVPLFIYAIFGSSRQLAVGPVALVSLLVSNVLGGIVNSSSKLYTEL AILLAFMVGILECLMGLLR*(-) MRQCHMQSWLGCTQFMGSTQALSRYLYMQYLARHDN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |