Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G21610_circ_g.9 |
| ID in PlantcircBase | ath_circ_003791 |
| Alias | Ath_circ_FC5246 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 7577628-7577896 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | u-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G21610 |
| Parent gene annotation |
Wound-responsive family protein |
| Parent gene strand | + |
| Alternative splicing | AT1G21610_circ_g.1 AT1G21610_circ_g.2 AT1G21610_circ_g.3 AT1G21610_circ_g.4 AT1G21610_circ_g.5 AT1G21610_circ_g.6 AT1G21610_circ_g.7 AT1G21610_circ_g.8 AT1G21610_circ_g.10 |
| Support reads | 2 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G21610.6:1 AT1G21610.5:1 AT1G21610.2:2 AT1G21610.3:2 AT1G21610.1:2 AT1G21610.4:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.263327002 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7577703-7577893(+) |
| Potential amino acid sequence |
MDAALEDKLCDLYDIFIDGLDEDQGPQTKKLYVNAIKPEGATSDDFQDSVEKPSLKKFVMDAAL EDKLCDLYDIFIDGLDEDQGPQTKKLYVNAIKPEGATSDDFQDSVEKPSLKKFVMDAALEDKLC DLYDIFIDGLDEDQGPQTKKLYVNAIKPEGATSDDFQDSVEKPSLKKFVMDAALEDKLCDLYDI FIDGLDEDQGPQTKKLYVN(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |