Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d020038_circ_g.2 |
| ID in PlantcircBase | zma_circ_009312 |
| Alias | Zm07circ00042, GRMZM2G130910_C1 |
| Organism | Zea mays |
| Position | chr7: 87809763-87810747 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d020038 |
| Parent gene annotation |
Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-2 0specific; SET domain protein 110 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d020038_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d020038_T004:3 Zm00001d020038_T001:3 Zm00001d020038_T005:3 Zm00001d020038_T002:3 Zm00001d020038_T007:4 Zm00001d020038_T006:3 Zm00001d020038_T003:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.104148689 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
87809863-87809765(-) |
| Potential amino acid sequence |
MLFSCCSSQCECDIACTNKSFQHRPLTKTKLIKQIENVFDQLISKIEQADPDFDPRPFLKQLNV LGRYEPIKRNVYFTKRYIEDYGISCHCKPSPGSSVVCGRDCYCSMLFSCCSSQCECDIACTNKS FQHRPLTKTKLIKQIENVFDQLISKIEQADPDFDPRPFLKQLNVLGRYEPIKRNVYFTKRYIED YGISCHCKPSPGSSVVCGRDCYCSMLFSCCSSQCECDIACTNKSFQHRPLTKTKLIKQIENVFD QLISKIEQADPDFDPRPFLKQLNVLGRYEPIKRNVYFTKRYIEDYGISCHCKPSPGSSVVCGRD CYCSMLFSCCSSQCECDIACTNKSFQHRPLTKTKLIK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |