Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0182400_circ_g.4 |
| ID in PlantcircBase | osa_circ_008709 |
| Alias | Os_ciR5206 |
| Organism | Oryza sativa |
| Position | chr11: 4138252-4139292 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os11g0182400 |
| Parent gene annotation |
WD40/YVTN repeat-like domain containing protein. (Os11t0182400-0 1) |
| Parent gene strand | - |
| Alternative splicing | Os11g0182400_circ_g.2 Os11g0182400_circ_g.3 Os11g0182400_circ_g.5 |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0182400-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.132325897 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4139266-4139289(-) 4138312-4139289(-) |
| Potential amino acid sequence |
MRDLYYKRNPQARSSGSNTSIKSYFKELALDEHASSFSRGPAEVYQWIGHPNQATICRMKSGSI LTGVGDKTLRLWSAESCKYMNEYIVPSSKMLVNFDFDENKE*(-) MSTLFQVLKCWSTLILMKIRNRVIDTAHLMRDLYYKRNPQARSSGSNTSIKSYFKELALDEHAS SFSRGPAEVYQWIGHPNQATICRMKSGSILTGVGDKTLRLWSAESCKYMNEYIVPSSKMLVNFD FDENKE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |