Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0421300_circ_g.5 |
ID in PlantcircBase | osa_circ_033547 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 13539041-13539381 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0421300 |
Parent gene annotation |
Similar to Alpha glucosidase-like protein. (Os07t0421300-01) |
Parent gene strand | + |
Alternative splicing | Os07g0421300_circ_g.2 Os07g0421300_circ_g.3 Os07g0421300_circ_g.4 Os07g0421300_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0421300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.130987121 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13539289-13539129(+) 13539374-13539129(+) |
Potential amino acid sequence |
MKFSASCTYPVILFGPFNTPSEVTTSLSHAIGYYLEHGCMGLWSRNHITISVTPLGTGCSS*(+ ) MQLVITWNTDAWDYGPGTTSLYQSHPWVLAVLPDGKALGVLADTTCRCEIDLRQESTMKFSASC TYPVILFGPFNTPSEVTTSLSHAIGYYLEHGCMGLWSRNHITISVTPLGTGCSS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |