Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0431000_circ_g.1 |
| ID in PlantcircBase | osa_circ_006861 |
| Alias | Os_ciR2085 |
| Organism | Oryza sativa |
| Position | chr10: 15362168-15362857 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os10g0431000 |
| Parent gene annotation |
Similar to predicted protein. (Os10t0431000-01);Non-protein codi ng transcript. (Os10t0431000-02);Similar to DNA-binding protein- like. (Os10t0431000-03) |
| Parent gene strand | + |
| Alternative splicing | Os10g0431000_circ_igg.1 Os10g0431000_circ_igg.2 Os10g0431000_circ_g.3 Os10g0431000_circ_g.4 Os10g0431000_circ_g.5 Os10g0431000_circ_g.6 Os10g0431000_circ_g.7 Os10g0431100_circ_ig.1 |
| Support reads | 8/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0431000-03:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_008425 |
| PMCS | 0.190734191 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15362189-15362174(+) 15362513-15362762(-) |
| Potential amino acid sequence |
MIPKNTSVLIRRIPGRPRKPIVTEPEETKAMEGRVEETMPSGSAFLADASMKYPEESEWDDEFG NDLYVSDSVPSQLGSQAVDASENKVDEDSKIKALIDTSALDYRIC*(+) MVSSTLPSMAFVSSGSVTIGFLGLPGIRRINTDVFFGIIVASSAYSIVECRCINKCFYFTIFIN FIFRCINRLATEL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |