Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G30980_circ_g.2 |
ID in PlantcircBase | ath_circ_015781 |
Alias | AT2G30980_C2 |
Organism | Arabidpsis thaliana |
Position | chr2: 13182778-13183082 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, MapSplice, circRNA_finder, CIRI-full, CIRI2 |
Parent gene | AT2G30980 |
Parent gene annotation |
SKdZeta |
Parent gene strand | - |
Alternative splicing | AT2G30980_circ_g.1 AT2G30980_circ_g.3 AT2G30980_circ_g.4 AT2G30980_circ_g.5 AT2G30980_circ_g.6 |
Support reads | 3 |
Tissues | root, aerial/leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G30980.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.60190349 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13183047-13182780(-) |
Potential amino acid sequence |
MNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTAVLGTPTREEIRCMNPN YTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTAVLGTPTREEIRCMNPNYTDF RFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTAVLGTPTREEIRCMNPNYTDFRFPQ IKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTA(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Chu et al., 2017;Liu et al., 2017;Zhang et al., 2019 |