Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0834000_circ_g.1 |
| ID in PlantcircBase | osa_circ_022598 |
| Alias | Os_ciR8992 |
| Organism | Oryza sativa |
| Position | chr3: 35047715-35049455 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os03g0834000 |
| Parent gene annotation |
Flap endonuclease-1b (EC 3.-.-.-) (OsFEN-1b). (Os03t0834000-01); Similar to Flap endonuclease 1b. (Os03t0834000-02) |
| Parent gene strand | + |
| Alternative splicing | Os03g0834000_circ_g.2 Os03g0834000_circ_g.3 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0834000-01:6 Os03t0834000-02:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.104670175 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35047729-35047744(+) 35047720-35048706(-) |
| Potential amino acid sequence |
MLNRTVRILEAGIKPVFVFDGEPPDMKKKELAKRSLKRDGSSEDLNRAIEVGDEDLIEKFSKRT VKVTKKHNEDCKRLLSLMGVPVVQAPGEAEAQCAALCENHKSSAGHVEPNC*(+) MTCDFHRVLRTVLLPPLVPELQGHPSSLTASYSLHCAFL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |