Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0834000_circ_g.1 |
ID in PlantcircBase | osa_circ_022598 |
Alias | Os_ciR8992 |
Organism | Oryza sativa |
Position | chr3: 35047715-35049455 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os03g0834000 |
Parent gene annotation |
Flap endonuclease-1b (EC 3.-.-.-) (OsFEN-1b). (Os03t0834000-01); Similar to Flap endonuclease 1b. (Os03t0834000-02) |
Parent gene strand | + |
Alternative splicing | Os03g0834000_circ_g.2 Os03g0834000_circ_g.3 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0834000-01:6 Os03t0834000-02:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.104670175 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35047729-35047744(+) 35047720-35048706(-) |
Potential amino acid sequence |
MLNRTVRILEAGIKPVFVFDGEPPDMKKKELAKRSLKRDGSSEDLNRAIEVGDEDLIEKFSKRT VKVTKKHNEDCKRLLSLMGVPVVQAPGEAEAQCAALCENHKSSAGHVEPNC*(+) MTCDFHRVLRTVLLPPLVPELQGHPSSLTASYSLHCAFL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |