Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0701300_circ_g.9 |
| ID in PlantcircBase | osa_circ_032220 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 29522417-29523095 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0701300 |
| Parent gene annotation |
Similar to ABC1 family protein. (Os06t0701300-01);Beta-lactamase family protein. (Os06t0701300-02);Similar to ABC1 family protei n. (Os06t0701300-03) |
| Parent gene strand | - |
| Alternative splicing | Os06g0701300_circ_g.3 Os06g0701300_circ_g.4 Os06g0701300_circ_g.5 Os06g0701300_circ_g.6 Os06g0701300_circ_g.7 Os06g0701300_circ_g.8 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0701300-02:3 Os06t0701300-03:3 Os06t0701300-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.212917378 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29523006-29522933(-) |
| Potential amino acid sequence |
MGWGNTLTRRLKVFSMALFIYFDYKAVQKRVKWVGAGKKDAIWTKTHERNARRVLNLMIELEGL WVKMGQYLSTRADVLPEPYINVLKQLQDSLPPRPLEEVRGTIEKELGKPMNDLFANFVLDPLAT ASKINRLAGSLELLTTVFQSFFVISSAVVLTSNGMGKHLNQAPQSLFHGLVYILRL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |