Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0521300_circ_g.7 |
| ID in PlantcircBase | osa_circ_014823 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 18996789-18999857 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0521300 |
| Parent gene annotation |
C2 domain containing protein. (Os02t0521300-01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0521300_circ_g.1 Os02g0521300_circ_g.2 Os02g0521300_circ_g.3 Os02g0521300_circ_g.4 Os02g0521300_circ_g.5 Os02g0521300_circ_g.6 Os02g0521300_circ_g.8 Os02g0521300_circ_g.9 Os02g0521300_circ_g.10 Os02g0521300_circ_g.11 Os02g0521300_circ_g.12 Os02g0521300_circ_g.13 |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0521300-01:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_011808 |
| PMCS | 0.103185997 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18998723-18996816(+) 18998731-18998668(-) |
| Potential amino acid sequence |
MTMGLLLVKNSWSPKFDAERDNLLGHVCRCY*(+) MVIVYSKSKEGALEELGRTEVILNSLNPSWNARINVHYQFEVLQPIVFQVYDIDPQFHDVNEKM LKLEEQQFLGEAVCLLSEVITKQNRLLTLKLGVSEHNLPNPSKFGELNVQAEESAGSKAIMEMV FRCSDLEIKDLLSKSDPFLLISRISESGVPVPICKTEVRKNDLNPKWKPVILNLQQIGSKENPL IIECFNFSSNGKHDLIGYLSLHQIWATKNSLPRAIPWSLYILKAKKEHLKNLGVLK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |