Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0521300_circ_g.1 |
ID in PlantcircBase | osa_circ_014817 |
Alias | Os_ciR7762 |
Organism | Oryza sativa |
Position | chr2: 18994826-18995280 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os02g0521300 |
Parent gene annotation |
C2 domain containing protein. (Os02t0521300-01) |
Parent gene strand | - |
Alternative splicing | Os02g0521300_circ_g.2 Os02g0521300_circ_g.3 Os02g0521300_circ_g.4 Os02g0521300_circ_g.5 Os02g0521300_circ_g.6 Os02g0521300_circ_g.7 Os02g0521300_circ_g.8 Os02g0521300_circ_g.9 Os02g0521300_circ_g.10 Os02g0521300_circ_g.11 Os02g0521300_circ_g.12 Os02g0521300_circ_g.13 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0521300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.174174212 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18995211-18994865(+) 18995174-18995266(-) 18994836-18995266(-) |
Potential amino acid sequence |
MDKGKSDAFMIASIVSWKSVTTPSMGILHWGELYHIP*(+) MEFLDPNKGERLESSTGRVASRDMIQFAPMKDAHGWCGD*(-) MPMDGVVTDFQETIDAIIKASDFPLSILVVGVGGADFKEMEFLDPNKGERLESSTGRVASRDMI QFAPMKDAHGWCGD*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |