Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0451700_circ_g.6 |
| ID in PlantcircBase | osa_circ_037272 |
| Alias | Os_ciR3189 |
| Organism | Oryza sativa |
| Position | chr8: 22085964-22092763 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ |
| Parent gene | Os08g0451700 |
| Parent gene annotation |
Conserved hypothetical protein. (Os08t0451700-01);Conserved hypo thetical protein. (Os08t0451700-02);Conserved hypothetical prote in. (Os08t0451700-03) |
| Parent gene strand | - |
| Alternative splicing | Os08g0451400_circ_ag.1 Os08g0451400_circ_ag.2 Os08g0451400_circ_ag.3 Os08g0451400_circ_ag.4 Os08g0451400_circ_g.1 Os08g0451500_circ_ag.1 Os08g0451500_circ_ag.2 Os08g0451500_circ_ag.3 Os08g0451500_circ_ag.4 Os08g0451500_circ_ag.5 Os08g0451500_circ_ag.6 Os08g0451700_circ_g.1 Os08g0451700_circ_g.2 Os08g0451700_circ_g.3 Os08g0451700_circ_g.4 Os08g0451700_circ_g.5 |
| Support reads | 4/3 |
| Tissues | root/shoot, root, pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0451700-01:12 Os08t0451700-02:12 Os08t0451700-03:12 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.439605137 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22092740-22086503(+) |
| Potential amino acid sequence |
MVELERCKALEPVEIELRKEAGISPIPHIATAAADANAAAAADHIASMVGKGGLVSELNIYGSD TSASPQTSVPISSSFSSC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |