Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0451700_circ_g.4 |
ID in PlantcircBase | osa_circ_037270 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 22084763-22085609 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0451700 |
Parent gene annotation |
Conserved hypothetical protein. (Os08t0451700-01);Conserved hypo thetical protein. (Os08t0451700-02);Conserved hypothetical prote in. (Os08t0451700-03) |
Parent gene strand | - |
Alternative splicing | Os08g0451400_circ_ag.1 Os08g0451400_circ_ag.2 Os08g0451400_circ_ag.3 Os08g0451400_circ_ag.4 Os08g0451400_circ_g.1 Os08g0451500_circ_ag.1 Os08g0451500_circ_ag.2 Os08g0451500_circ_ag.3 Os08g0451500_circ_ag.4 Os08g0451500_circ_ag.5 Os08g0451500_circ_ag.6 Os08g0451700_circ_g.1 Os08g0451700_circ_g.2 Os08g0451700_circ_g.3 Os08g0451700_circ_g.5 Os08g0451700_circ_g.6 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0451700-02:3 Os08t0451700-01:2 Os08t0451700-03:3 |
Conservation Information | |
---|---|
Conserved circRNAs |
osi_circ_007777* osi_circ_017954 osi_circ_007776* osi_circ_017952 |
PMCS | 0.423295488 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22085558-22084823(+) |
Potential amino acid sequence |
MVEQKNTTDPQPLNPAKASQATGDQMVHGSHSYSCRGC*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |