Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_15G046000_circ_g.4 |
| ID in PlantcircBase | gma_circ_003998 |
| Alias | Gm15circRNA1364, circRNA527 |
| Organism | Glycine max |
| Position | chr15: 3669603-3669820 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat, CIRI, CIRI, CIRCexplorer |
| Parent gene | GLYMA_15G046000 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_15G046000_circ_g.1 GLYMA_15G046000_circ_g.2 GLYMA_15G046000_circ_g.3 GLYMA_15G046000_circ_g.5 |
| Support reads | NA |
| Tissues | leaf, root, stem, pod |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH10417:1 KRH10416:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.582381995 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3669706-3669757(-) |
| Potential amino acid sequence |
MDAVSDLLPAFAKSMGAQFAPIFAQLFEPLMKFATCPSLLMQLHCCFGSNLPVSR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a; Ma et al., 2021a |