Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_15G046000_circ_g.1 |
| ID in PlantcircBase | gma_circ_003995 |
| Alias | Gm15circRNA1363, gma-circRNA2125 |
| Organism | Glycine max |
| Position | chr15: 3668576-3669820 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat, CIRI, find_circ |
| Parent gene | GLYMA_15G046000 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_15G046000_circ_g.2 GLYMA_15G046000_circ_g.3 GLYMA_15G046000_circ_g.4 GLYMA_15G046000_circ_g.5 |
| Support reads | NA |
| Tissues | leaf, root, stem, flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH10416:5 KRH10417:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.153756693 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3669706-3669757(-) |
| Potential amino acid sequence |
MDAVSDLLPAFAKSMGAQFAPIFAQLFEPLMKFAKSSRPPQDRTMVVACLAEVAQNMGSPIASY VDRVMPLVLKELASSEATNRRNAAFCVGELCKNGHEQALKYYDNILRGLHPLFGESEPDDAVRD NAAGAVARMIMVHPESIPLNQVLPVFLRVLPLKEDHEESMAVYSCVFSLVFSSNPQTCPSLLMQ LHCCFGSNLPVSR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | cytoplasmic male sterility |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a; Chen et al., 2018 |