Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0603900_circ_g.2 |
| ID in PlantcircBase | osa_circ_015377 |
| Alias | Os02circ17709/Os_ciR7868 |
| Organism | Oryza sativa |
| Position | chr2: 23653922-23654769 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ui-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
| Parent gene | Os02g0603900 |
| Parent gene annotation |
Hypothetical protein. (Os02t0603900-00) |
| Parent gene strand | + |
| Alternative splicing | Os02g0603900_circ_g.1 Os02g0603900_circ_g.3 Os02g0603900_circ_g.4 Os02g0603900_circ_g.5 |
| Support reads | 2/2/2 |
| Tissues | leaf and panicle/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0603800-01:4 Os02t0603900-00:4 Os02t0603800-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004070* |
| PMCS | 0.378670578 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23654446-23654763(-) 23654213-23654763(-) |
| Potential amino acid sequence |
MRNTKTEYVSCPSCGRTLFDLQEVSAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGA PGKIDLYVGKVI*(-) MSLVLLVGGHSLTSKKSVLRLERRPLICQASLLLSWVALSMGQGRWPMLISDTLEVLLGRSTFM LARLFEYLETNGLNFPVIHHIEFPKSVNRDDLVIGAGANVGALLVDGLGDGVLLEAADQEFEFL RDTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEVSAQIREKTSHLPGVSIAIMGCIVNGPGE MADADFGYVGGAPGKIDLYVGKVI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |