Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0603900_circ_g.1 |
ID in PlantcircBase | osa_circ_015376 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 23653922-23654586 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ui-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0603900 |
Parent gene annotation |
Hypothetical protein. (Os02t0603900-00) |
Parent gene strand | + |
Alternative splicing | Os02g0603900_circ_g.2 Os02g0603900_circ_g.3 Os02g0603900_circ_g.4 Os02g0603900_circ_g.5 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0603800-01:3 Os02t0603800-01:3 Os02t0603900-00:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.189889637 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23654446-23654583(-) 23654213-23654583(-) |
Potential amino acid sequence |
MRNTKTEYVSCPSCGRTLFDLQEVSAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGA PGKIDLYVGKR*(-) MSLVLLVGGHSLTSKKSVLRLERRPLICQASLLLSWVALSMGQGRWPMLISDTLEVLLGRSTFM LARDDLVIGAGANVGALLVDGLGDGVLLEAADQEFEFLRDTSFNLLQGCRMRNTKTEYVSCPSC GRTLFDLQEVSAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKR*(- ) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |