Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G05160_circ_g.3 |
ID in PlantcircBase | ath_circ_000771 |
Alias | Ath_circ_FC0184, AT1G05160_C1 |
Organism | Arabidpsis thaliana |
Position | chr1: 1488019-1488479 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, PcircRNA_finder, CIRI2 |
Parent gene | AT1G05160 |
Parent gene annotation |
Ent-kaurenoic acid oxidase 1 |
Parent gene strand | - |
Alternative splicing | AT1G05160_circ_g.1 AT1G05160_circ_g.2 |
Support reads | 5 |
Tissues | root, inflorescences, whole_plant, leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G05160.1:3 AT1G05160.2:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.390559339 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1488468-1488021(-) |
Potential amino acid sequence |
MILKSRPEGQKGLSLKETRKMEFLSQVVDETLRVITFSLTAFREAKTDVEMNGYLIPKGWKVLT WFRDVHIDPEVFPDPRKFDPARWDAEQEMILKSRPEGQKGLSLKETRKMEFLSQVVDETLRVIT FSLTAFREAKTDVEMNGYLIPKGWKVLTWFRDVHIDPEVFPDPRKFDPARWDAEQEMILKSRPE GQKGLSLKETRKMEFLSQVVDETLRVITFSLTAFREAKTDVEMNGYLIPKGWKVLTWFRDVHID PEVFPDPRKFDPARWDAEQEMILKSRPEGQKGLSLKETRKMEFLSQVVDETLRVITFSLTAFRE AKTDVEMNGYLIPKGWKVLTWFRDVHIDPEVFPDPRKFDPARWD(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Chu et al., 2017;Chen et al., 2017a;Zhang et al., 2019 |