Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA008057_circ_g.2 |
ID in PlantcircBase | osi_circ_003856 |
Alias | 2:13407467|13409001 |
Organism | Oryza sativa ssp. indica |
Position | chr2: 13407467-13409001 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA008057 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA008057_circ_g.1 BGIOSGA008057_circ_g.3 BGIOSGA008057_circ_g.4 BGIOSGA008057_circ_g.5 BGIOSGA008057_circ_g.6 BGIOSGA008057_circ_g.7 BGIOSGA008057_circ_g.8 BGIOSGA008057_circ_g.9 BGIOSGA008057_circ_g.10 BGIOSGA008057_circ_ag.1 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA008057-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13407688-13407547(+) |
Potential amino acid sequence |
MNSYQRIEITKPKLECNEETNIDALQEDETLSVDYKNDVSIHDYLPAMKAICDKLEEASGKVLA VSDIKKDLSYRMQPGHRAWRNVDCSLLTSLKRFNPDEFKPKGTISNYKLGKKGLETDQVMELPL DNCIYDMIDAQEPKGITLIEDFWSHTTQSKQRGRDKRKQLPLCCEDT*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |