Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0167500_circ_g.1 |
| ID in PlantcircBase | osa_circ_029812 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 3411959-3417065 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0167500 |
| Parent gene annotation |
Leucine-rich repeat, plant specific containing protein. (Os06t01 67500-01);Hypothetical conserved gene. (Os06t0167500-02);Hypothe tical conserved gene. (Os06t0167500-03) |
| Parent gene strand | + |
| Alternative splicing | Os06g0167500_circ_g.2 Os06g0167500_circ_g.3 Os06g0167500_circ_g.4 Os06g0167500_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0167500-02:8 Os06t0167500-01:9 Os06t0167500-03:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.090437015 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3411964-3412029(+) |
| Potential amino acid sequence |
MFDNDIEGMVPGFIANFANLTDLRMYGMKLQGPIPENFSKLINIENLMIGDLDTEGYPFNFTGD WVNLSTLSLRNCGFTGKFPNQILKNLNKLTYVDLRSNNLSGSIDLQQYDSSLKYLYVGENNFNG SLPDQMPQSLVALDVTYNPLLRGRLPSSSADRKMRINYIGTSIGAGSSVGSENLRLLNCVDMKG CNTTGLTSGCLIMTSKEWFQDLLRTLPILQI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |