Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0167500_circ_g.4 |
ID in PlantcircBase | osa_circ_029815 |
Alias | Os_ciR1161 |
Organism | Oryza sativa |
Position | chr6: 3415001-3416249 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
Parent gene | Os06g0167500 |
Parent gene annotation |
Leucine-rich repeat, plant specific containing protein. (Os06t01 67500-01);Hypothetical conserved gene. (Os06t0167500-02);Hypothe tical conserved gene. (Os06t0167500-03) |
Parent gene strand | + |
Alternative splicing | Os06g0167500_circ_g.1 Os06g0167500_circ_g.2 Os06g0167500_circ_g.3 Os06g0167500_circ_g.5 |
Support reads | 16/5 |
Tissues | root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0167500-02:3 Os06t0167500-03:3 Os06t0167500-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_016706 |
PMCS | 0.313556952 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3415045-3416246(+) |
Potential amino acid sequence |
MPQSLVALDVTYNPLLRGRLPSSSADRKMRINYIGTSIGAGSSVGSYVGENNFNGSLPDQMPQS LVALDVTYNPLLRGRLPSSSADRKMRINYIGTSIGAGSSVGSYVGENNFNGSLPDQMPQSLVAL DVTYNPLLRGRLPSSSADRKMRINYIGTSIGAGSSVGSYVGENNFNGSLPDQMPQSLVALDVTY NPLLRGRLPSSSADRKMRINYIGTSIGAGSSVG(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |