Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_14G161400_circ_g.4 |
| ID in PlantcircBase | gma_circ_003901 |
| Alias | Gm14circRNA1415 |
| Organism | Glycine max |
| Position | chr14: 38189418-38190608 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat |
| Parent gene | GLYMA_14G161400 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_14G161400_circ_g.1 GLYMA_14G161400_circ_g.2 GLYMA_14G161400_circ_g.3 |
| Support reads | NA |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH16546:4 KRH16547:4 KRH16548:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.06873262 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
38190555-38190558(-) |
| Potential amino acid sequence |
MEDFYDIKTLKIGGQSICLFGIFDGHGGSRAAEYLKEHLFDNLLKHPKFLTDAKLAISETYQQT DANFLDSEKDTFRDDGSTASTAVLVDNHLYVANVGDSRTIISKAGKANALSEDHKPNRSDERKR IENAGGVVMWAVTMEDLAVGIQVLGERE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a |