Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0247651_circ_g.9 |
| ID in PlantcircBase | osa_circ_030377 |
| Alias | Os_ciR10806 |
| Organism | Oryza sativa |
| Position | chr6: 7652690-7653409 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os06g0247500 |
| Parent gene annotation |
Pyrophosphate-fructose 6-phosphate 1-phosphotransferase (PFP) be ta subunit, Regulation of carbon metabolism during grain filling (Os06t0247500-01);Similar to pyrophosphate--fructose 6-phosphat e 1-phosphotransferase beta subunit. (Os06t0247500-02) |
| Parent gene strand | - |
| Alternative splicing | Os06g0247651_circ_g.4 Os06g0247651_circ_g.5 Os06g0247651_circ_g.6 Os06g0247651_circ_g.7 Os06g0247651_circ_g.8 Os06g0247651_circ_g.10 Os06g0247651_circ_g.11 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0247651-00:3 Os06t0247500-01:3 Os06t0247651-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.195515856 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7652758-7653327(-) 7653379-7653327(-) |
| Potential amino acid sequence |
MGLLSLVVMIQTQTHAFLLSTSDYLQEYAKGSVMYGFKGGPAGVMKCKYVELTADYVYPYRNQG GFDMICSGRDKIETPEQFKQAEDTVNKLDLDGLVVIGGDDSNTNACLLAEYFRLPAGICKRIRH VWIQGRSSWSHEVQVR*(-) MYGFKGGPAGVMKCKYVELTADYVYPYRNQGGFDMICSGRDKIETPEQFKQAEDTVNKLDLDGL VVIGGDDSNTNACLLAEYFRLPAGICKRIRHVWIQGRSSWSHEVQVR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |