Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d035960_circ_g.11 |
ID in PlantcircBase | zma_circ_008934 |
Alias | zma_circ_0002490 |
Organism | Zea mays |
Position | chr6: 62663511-62664745 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d035960 |
Parent gene annotation |
DNA-directed RNA polymerase III subunit 2 |
Parent gene strand | + |
Alternative splicing | Zm00001d035960_circ_g.1 Zm00001d035960_circ_g.2 Zm00001d035960_circ_g.3 Zm00001d035960_circ_g.4 Zm00001d035960_circ_g.5 Zm00001d035960_circ_g.6 Zm00001d035960_circ_g.7 Zm00001d035960_circ_g.8 Zm00001d035960_circ_g.9 Zm00001d035960_circ_g.10 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d035960_T005:6 Zm00001d035960_T002:5 Zm00001d035960_T018:6 Zm00001d035960_T015:6 Zm00001d035960_T028:6 Zm00001d035960_T009:6 Zm00001d035960_T003:6 Zm00001d035960_T001:6 Zm00001d035960_T008:6 Zm00001d035960_T007:6 Zm00001d035960_T029:5 Zm00001d035960_T006:6 Zm00001d035960_T021:6 Zm00001d035960_T024:6 Zm00001d035960_T026:6 Zm00001d035960_T004:6 Zm00001d035960_T019:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.147628826 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
62663713-62663541(+) 62664734-62663581(+) 62663715-62664723(-) |
Potential amino acid sequence |
MGYSGYDIEDAIVMNKSSLDRGFGRCIALKKYTVLKDNYGDGVSDMIVEPQRDNGVLIKQNMRA LDEDGIAGPGQIIRNHDIYVNKRTPKNTSKGIGRALRESDYKDSPALYKGVDGETTVVDRVMLC SDTNDKLSIKCIIRHTRRPEVGDKFSSRHGQKGVCGTIVQQEDFPFSERGICPDLIMNPHGFPS CSEQIHYCTY*(+) MVSQVVQSRFTTVLTSVCTTATANDENY*(+) MTATVAFCPAPSLSYPTNSIVFVVSSGRCAYTSKYSSESALNNLGNHVDS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |