Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d035960_circ_g.10 |
| ID in PlantcircBase | zma_circ_008933 |
| Alias | zma_circ_0002489, ZmciR278 |
| Organism | Zea mays |
| Position | chr6: 62662267-62664745 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d035960 |
| Parent gene annotation |
DNA-directed RNA polymerase III subunit 2 |
| Parent gene strand | + |
| Alternative splicing | Zm00001d035960_circ_g.1 Zm00001d035960_circ_g.2 Zm00001d035960_circ_g.3 Zm00001d035960_circ_g.4 Zm00001d035960_circ_g.5 Zm00001d035960_circ_g.6 Zm00001d035960_circ_g.7 Zm00001d035960_circ_g.8 Zm00001d035960_circ_g.9 Zm00001d035960_circ_g.11 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d035960_T009:10 Zm00001d035960_T028:10 Zm00001d035960_T005:10 Zm00001d035960_T001:10 Zm00001d035960_T026:10 Zm00001d035960_T004:10 Zm00001d035960_T024:10 Zm00001d035960_T007:10 Zm00001d035960_T021:10 Zm00001d035960_T018:10 Zm00001d035960_T002:8 Zm00001d035960_T015:10 Zm00001d035960_T019:10 Zm00001d035960_T029:5 Zm00001d035960_T006:10 Zm00001d035960_T008:10 Zm00001d035960_T003:10 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.145339428 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
62662328-62662315(+) 62662271-62664673(-) |
| Potential amino acid sequence |
MGISRIDETHMEKLRHGTCGFDDFLRDGLIEYLDVNEENNALIALYEHMDQDDVERSSITHIEI EPLSILGVVSGLIPYPHHNQSPRNTYQCAMGKQAMGNIAYNQLFRADSLLYLLVYAQRPLLTTK TIELVGYDKLGAGQNATVAVMGYSGYDIEDAIVMNKSSLDRGFGRCIALKKYTVLKDNYGDGVS DMIVEPQRDNGVLIKQNMRALDEDGIAGPGQIIRNHDIYVNKRTPKNTSKGIGRALRESDYKDS PALYKGVDGETTVVDRVMLCSDTNDKLSIKCIIRHTRRPEVGDKFSSRHGQKGVCGTIVQQEDF PFSERGICPDLIMNPHGFPSIAFTLPLMVAVFVAHL*(+) MLGKPCGFMIKSGQIPLSEKGKSSC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |