Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0166500_circ_g.4 |
| ID in PlantcircBase | osa_circ_010595 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 3366041-3366159 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0166500 |
| Parent gene annotation |
Similar to Nrap protein, expressed. (Os12t0166500-01) |
| Parent gene strand | + |
| Alternative splicing | Os12g0166500_circ_g.5 Os12g0166500_circ_g.6 Os12g0166500_circ_g.7 Os12g0166500_circ_g.8 Os12g0166500_circ_g.9 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0166500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.292019888 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3366058-3366073(+) 3366080-3366073(+) |
| Potential amino acid sequence |
MFVTASEDEVNVLTSGYSFLLKIFHERGLLLQKRVWRIKECLLLPVKMRSMFLHLDIHSCLRYF TKEVCCYKNESGGSRNVCYCQ*(+) MRSMFLHLDIHSCLRYFTKEVCCYKNESGGSRNVCYCQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |