Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0502500_circ_g.1 |
ID in PlantcircBase | osa_circ_028426 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 24730459-24731886 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0502500 |
Parent gene annotation |
Conserved hypothetical protein. (Os05t0502500-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0502500-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_002781 |
PMCS | 0.204836035 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24731823-24730519(+) 24731164-24730541(-) |
Potential amino acid sequence |
MSWPAKKKNAARPKIGSSIVRSLRTTFEGLTEGLSTCGGPSR*(+) MVHNCVHIVLNLSRCRETNLLENLLDFHLEGPPQVLKPSVSPSNVVRRLLTILLPILGLAAFFF FAGQDILQSNCPNCGKSFQILKSSLKDGPQLCPYCTQPFSVQGNKFVRESARFSSGRTTTGAQA FSESFKRGSEASHNTAAYFGSRCIFLLCRPRHTSEQLPQLRKKLPDTEVIFEGWSTTVSILYST FLGAGKQIC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |