Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc11g012770.1_circ_g.1 |
ID in PlantcircBase | sly_circ_003291 |
Alias | NA |
Organism | Solanum lycopersicum |
Position | chr11: 5534827-5535370 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | Segemehl, CIRI |
Parent gene | Solyc11g012770.1 |
Parent gene annotation |
protein_coding |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Solyc11g012770.1.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.203127451 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5534841-5534844(+) 5535210-5535364(-) |
Potential amino acid sequence |
MLERICLEGSRRQAKYAIHALASIMKDDGLKSLSVLYKRLVDMLEEKSHLPAVLQSLGCVAQTA MPVFETREKEIEQFITKNILELSHTSEGKAKESWEDRSEICSMKVFRPYA*(+) MFFVMNCSISFSLVSKTGIAVCATHPRDCSTAGKCDFSSSISTSLLYRTDNDLSPSSFIIEASA CIAYLACLRLPSKQILSSIRSKDLH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Tan et al., 2017 |