Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0155601_circ_g.4 |
ID in PlantcircBase | osa_circ_026645 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 3252708-3252836 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0155601 |
Parent gene annotation |
Importin alpha-1b subunit. (Os05t0155601-00) |
Parent gene strand | - |
Alternative splicing | Os05g0155601_circ_g.2 Os05g0155601_circ_g.3 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0155601-00:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.925701495 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3252781-3252740(+) |
Potential amino acid sequence |
MIVGQEVQETWKSLMIDDTLNLFPIASSDV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |