Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0212400_circ_g.1 |
ID in PlantcircBase | osa_circ_018481 |
Alias | Os03circ06716/Os_ciR4401 |
Organism | Oryza sativa |
Position | chr3: 5862051-5863345 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
Parent gene | Os03g0212400 |
Parent gene annotation |
Similar to SNAP25 homologous protein SNAP29. (Os03t0212400-01) |
Parent gene strand | + |
Alternative splicing | Os03g0212400_circ_g.2 Os03g0212400_circ_g.3 Os03g0212400_circ_g.4 Os03g0212400_circ_g.5 |
Support reads | 3/5/3 |
Tissues | leaf and panicle/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0212400-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014039 |
PMCS | 0.355666718 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5862100-5862078(+) |
Potential amino acid sequence |
MDKKQTSLGTPVYRTNPFDSDSDSEVPSRPSRAQSVPVRRTDQSIQELEDYAVDKVEETSRKVN DCVRAAEAIREDATKTLVTLHRQGEQITRTHRVAADIEHDLSMSEKLLGSLGGLFSKTWKPKRN QQIKGPISQNNSFTSSANHMEQRQRLGISSTRQPSPNQVHRSPATAIEKVQVEIAKQDDALSDL SNMLGELKGMALDMGTEIERLLQTTPVSE*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |