Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G33200_circ_g.16 |
| ID in PlantcircBase | ath_circ_034350 |
| Alias | At_ciR5039 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 16012194-16012343 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT4G33200 |
| Parent gene annotation |
myosin, putative |
| Parent gene strand | - |
| Alternative splicing | AT4G33200_circ_g.11 AT4G33200_circ_g.12 AT4G33200_circ_g.13 AT4G33200_circ_g.14 AT4G33200_circ_g.15 AT4G33200_circ_g.17 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G33200.2:1 AT4G33200.3:1 AT4G33200.4:1 AT4G33200.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.384439444 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16012227-16012196(-) |
| Potential amino acid sequence |
MDIVGISQDEQDAEKYKLSNPRQFHYLNQSKTYELEGVSSAEEYKNTRRAMDIVGISQDEQDAE KYKLSNPRQFHYLNQSKTYELEGVSSAEEYKNTRRAMDIVGISQDEQDAEKYKLSNPRQFHYLN QSKTYELEGVSSAEEYKNTRRAMDIVGISQDEQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |