Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G33200_circ_g.16 |
ID in PlantcircBase | ath_circ_034350 |
Alias | At_ciR5039 |
Organism | Arabidpsis thaliana |
Position | chr4: 16012194-16012343 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full |
Parent gene | AT4G33200 |
Parent gene annotation |
myosin, putative |
Parent gene strand | - |
Alternative splicing | AT4G33200_circ_g.11 AT4G33200_circ_g.12 AT4G33200_circ_g.13 AT4G33200_circ_g.14 AT4G33200_circ_g.15 AT4G33200_circ_g.17 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT4G33200.2:1 AT4G33200.3:1 AT4G33200.4:1 AT4G33200.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.384439444 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16012227-16012196(-) |
Potential amino acid sequence |
MDIVGISQDEQDAEKYKLSNPRQFHYLNQSKTYELEGVSSAEEYKNTRRAMDIVGISQDEQDAE KYKLSNPRQFHYLNQSKTYELEGVSSAEEYKNTRRAMDIVGISQDEQDAEKYKLSNPRQFHYLN QSKTYELEGVSSAEEYKNTRRAMDIVGISQDEQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |