Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0161800_circ_g.3 |
| ID in PlantcircBase | osa_circ_018077 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 3339602-3340128 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0161800 |
| Parent gene annotation |
Similar to SIPL. (Os03t0161800-01);Similar to 1,2-dihydroxy-3-ke to-5-methylthiopentene dioxygenase 2. (Os03t0161800-02) |
| Parent gene strand | + |
| Alternative splicing | Os03g0161800_circ_igg.1 Os03g0161800_circ_g.1 Os03g0161800_circ_g.2 Os03g0161800_circ_g.4 Os03g0161800_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0161800-02:2 Os03t0161800-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.25635408 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3339695-3339604(+) |
| Potential amino acid sequence |
MDICDVCPEKLPNYEAKLKNFFEEHLHTDEEIRYCLEGSGYFDVRDQNDQWIRVAVKKGGMIVL PAGMYHRFTLDSDNYIKS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |