Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d003655_circ_g.1 |
| ID in PlantcircBase | zma_circ_007175 |
| Alias | zma_circ_0001064, GRMZM2G013283_C1 |
| Organism | Zea mays |
| Position | chr2: 52508067-52508630 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d003655 |
| Parent gene annotation |
DExH-box ATP-dependent RNA helicase DExH7 chloroplastic |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d003655_T024:3 Zm00001d003655_T018:3 Zm00001d003655_T002:3 Zm00001d003655_T009:3 Zm00001d003655_T026:3 Zm00001d003655_T019:3 Zm00001d003655_T006:3 Zm00001d003655_T016:3 Zm00001d003655_T001:3 Zm00001d003655_T014:3 Zm00001d003655_T004:2 Zm00001d003655_T010:3 Zm00001d003655_T027:3 Zm00001d003655_T025:3 Zm00001d003655_T005:3 Zm00001d003655_T003:2 Zm00001d003655_T012:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.174843587 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
52508068-52508067(+) |
| Potential amino acid sequence |
MMLYGAIFGCLSPILSVAAFLSYKSPFLSPKDENGDKSARQFCHSFYLNSTVMHMIR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |