Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d003655_circ_g.1 |
ID in PlantcircBase | zma_circ_007175 |
Alias | zma_circ_0001064, GRMZM2G013283_C1 |
Organism | Zea mays |
Position | chr2: 52508067-52508630 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d003655 |
Parent gene annotation |
DExH-box ATP-dependent RNA helicase DExH7 chloroplastic |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d003655_T024:3 Zm00001d003655_T018:3 Zm00001d003655_T002:3 Zm00001d003655_T009:3 Zm00001d003655_T026:3 Zm00001d003655_T019:3 Zm00001d003655_T006:3 Zm00001d003655_T016:3 Zm00001d003655_T001:3 Zm00001d003655_T014:3 Zm00001d003655_T004:2 Zm00001d003655_T010:3 Zm00001d003655_T027:3 Zm00001d003655_T025:3 Zm00001d003655_T005:3 Zm00001d003655_T003:2 Zm00001d003655_T012:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.174843587 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
52508068-52508067(+) |
Potential amino acid sequence |
MMLYGAIFGCLSPILSVAAFLSYKSPFLSPKDENGDKSARQFCHSFYLNSTVMHMIR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |