Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0332800_circ_g.1 |
ID in PlantcircBase | osa_circ_001614 |
Alias | Os01circ10593 |
Organism | Oryza sativa |
Position | chr1: 12917350-12918565 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl |
Parent gene | Os01g0332800 |
Parent gene annotation |
Similar to Serine carboxypeptidase II-like protein. (Os01t033280 0-01);Similar to SCPL33. (Os01t0332800-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 4/1 |
Tissues | leaf/shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0332800-01:4 Os01t0332800-02:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002033* osi_circ_009326 |
PMCS | 0.331559264 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12918552-12918255(+) 12918514-12918257(-) |
Potential amino acid sequence |
MSNQDNKSFQIDMLVCFNMLVALIHYISKLRNIVPCIALSRDVEVMVFVLRKPLEPIHQEIVGV LSDKTVIDAL*(+) MVNGNGTGLEFNKFAWNNEANLLFLESPVGVGFSYTNTSSDLESIDDRFVAEDTYNFLVNWFKR FPQYKNHDFYISGESYAGHYVPQLADVVYERNKHVETNQHINLKGFIVLVAHLWAMEQLLNWVL SWSMEMEQVWNSTSLHGITRPICCSWNLLLESASPTQIPRLT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Chu et al., 2017 |