Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0332800_circ_g.1 |
| ID in PlantcircBase | osa_circ_001614 |
| Alias | Os01circ10593 |
| Organism | Oryza sativa |
| Position | chr1: 12917350-12918565 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os01g0332800 |
| Parent gene annotation |
Similar to Serine carboxypeptidase II-like protein. (Os01t033280 0-01);Similar to SCPL33. (Os01t0332800-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4/1 |
| Tissues | leaf/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0332800-01:4 Os01t0332800-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002033* osi_circ_009326 |
| PMCS | 0.331559264 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12918552-12918255(+) 12918514-12918257(-) |
| Potential amino acid sequence |
MSNQDNKSFQIDMLVCFNMLVALIHYISKLRNIVPCIALSRDVEVMVFVLRKPLEPIHQEIVGV LSDKTVIDAL*(+) MVNGNGTGLEFNKFAWNNEANLLFLESPVGVGFSYTNTSSDLESIDDRFVAEDTYNFLVNWFKR FPQYKNHDFYISGESYAGHYVPQLADVVYERNKHVETNQHINLKGFIVLVAHLWAMEQLLNWVL SWSMEMEQVWNSTSLHGITRPICCSWNLLLESASPTQIPRLT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |