Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0147500_circ_g.2 |
| ID in PlantcircBase | osa_circ_026563 |
| Alias | Os05circ02698/Os_ciR825 |
| Organism | Oryza sativa |
| Position | chr5: 2726980-2728049 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, find_circ |
| Parent gene | Os05g0147500 |
| Parent gene annotation |
Similar to DEGP2 (DEGP PROTEASE 2); serine-type peptidase/ tryps in. (Os05t0147500-01);Serine endopeptidase DegP2 domain containi ng protein. (Os05t0147500-02);Similar to DEGP2 (DEGP PROTEASE 2) ; serine-type peptidase/ trypsin. (Os05t0147500-03) |
| Parent gene strand | + |
| Alternative splicing | Os05g0147500_circ_g.1 |
| Support reads | 58/29/12 |
| Tissues | leaf and panicle/root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0147500-02:3 Os05t0147500-03:1 Os05t0147500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_005961* osi_circ_015791 |
| PMCS | 0.456591466 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2727481-2728046(+) 2728028-2727480(+) 2727041-2727500(-) |
| Potential amino acid sequence |
MIGDGKLLTNAHCVEHDTQVKVKRRGDDKKYIAKVYCTHIAPDYGLPWQKQRQHASTGSAFMIG DGKLLTNAHCVEHDTQVKVKRRGDDKKYIAKVYCTHIAPDYGLPWQKQRQHASTGSAFMIGDGK LLTNAHCVEHDTQVKVKRRGDDKKYIAKVYCTHIAPDYGLPWQKQRQHASTGSAFMIGDGKLLT NAHCVEHDTQVKVKRRGDDKKYIAK(+) MTKNILPRSIALILHLIMGFLGRSKGNMQAQGVPL*(+) MLPLLLPRKPIIRCNMSAIDLGNIFFVISPSLYFDLGVMLNTMCICQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to Pi-starvation |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |