Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0147500_circ_g.2 |
ID in PlantcircBase | osa_circ_026563 |
Alias | Os05circ02698/Os_ciR825 |
Organism | Oryza sativa |
Position | chr5: 2726980-2728049 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, find_circ |
Parent gene | Os05g0147500 |
Parent gene annotation |
Similar to DEGP2 (DEGP PROTEASE 2); serine-type peptidase/ tryps in. (Os05t0147500-01);Serine endopeptidase DegP2 domain containi ng protein. (Os05t0147500-02);Similar to DEGP2 (DEGP PROTEASE 2) ; serine-type peptidase/ trypsin. (Os05t0147500-03) |
Parent gene strand | + |
Alternative splicing | Os05g0147500_circ_g.1 |
Support reads | 58/29/12 |
Tissues | leaf and panicle/root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0147500-02:3 Os05t0147500-03:1 Os05t0147500-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005961* osi_circ_015791 |
PMCS | 0.456591466 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2727481-2728046(+) 2728028-2727480(+) 2727041-2727500(-) |
Potential amino acid sequence |
MIGDGKLLTNAHCVEHDTQVKVKRRGDDKKYIAKVYCTHIAPDYGLPWQKQRQHASTGSAFMIG DGKLLTNAHCVEHDTQVKVKRRGDDKKYIAKVYCTHIAPDYGLPWQKQRQHASTGSAFMIGDGK LLTNAHCVEHDTQVKVKRRGDDKKYIAKVYCTHIAPDYGLPWQKQRQHASTGSAFMIGDGKLLT NAHCVEHDTQVKVKRRGDDKKYIAK(+) MTKNILPRSIALILHLIMGFLGRSKGNMQAQGVPL*(+) MLPLLLPRKPIIRCNMSAIDLGNIFFVISPSLYFDLGVMLNTMCICQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to Pi-starvation |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |