Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0301200_circ_g.3 |
| ID in PlantcircBase | osa_circ_033429 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 11888063-11889225 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0301200 |
| Parent gene annotation |
Similar to RNA helicase (Fragment). (Os07t0301200-01);Similar to STRS1 (STRESS RESPONSE SUPPRESSOR 1); ATP-dependent helicase. ( Os07t0301200-02) |
| Parent gene strand | - |
| Alternative splicing | Os07g0301200_circ_g.2 Os07g0301200_circ_g.4 Os07g0301200_circ_g.5 Os07g0301200_circ_g.6 Os07g0301200_circ_g.7 Os07g0301200_circ_g.8 Os07g0301200_circ_g.9 Os07g0301200_circ_g.10 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0301200-01:3 Os07t0301200-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.131508276 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11889172-11889040(-) 11888141-11889040(-) |
| Potential amino acid sequence |
MLQRRGWSAVSVHGDKAQHDRTKALSLFKEGSCPLMIATDVASRGLDIPDVEVVINYSYPLTTE DYVHRIGRTGRAGKKGVAHTFFTQENKKQGVGFCVVQERSYASRNNVTKKGLECCFCSWR*(-) MSTGLGGPVVLARKVLHIPSSLKRTRNRVLVFVLYKREATRVETMLQRRGWSAVSVHGDKAQHD RTKALSLFKEGSCPLMIATDVASRGLDIPDVEVVINYSYPLTTEDYVHRIGRTGRAGKKGVAHT FFTQENKKQGVGFCVVQERSYASRNNVTKKGLECCFCSWR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |