Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0744800_circ_g.1 |
| ID in PlantcircBase | osa_circ_021847 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 30597682-30598157 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0744800 |
| Parent gene annotation |
emp24/gp25L/p24 family protein. (Os03t0744800-01);Similar to emp 24/gp25L/p24 protein-related. (Os03t0744800-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0744800-02:2 Os03t0744800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013633 |
| PMCS | 0.231093943 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30598075-30598107(-) |
| Potential amino acid sequence |
MYKFCFHNPYGAPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELKEALESVTAEQKYLKAR EARHRHSNFTRWQHCVYIEGEVW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |