Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0744800_circ_g.1 |
ID in PlantcircBase | osa_circ_021847 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 30597682-30598157 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0744800 |
Parent gene annotation |
emp24/gp25L/p24 family protein. (Os03t0744800-01);Similar to emp 24/gp25L/p24 protein-related. (Os03t0744800-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0744800-02:2 Os03t0744800-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_013633 |
PMCS | 0.231093943 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30598075-30598107(-) |
Potential amino acid sequence |
MYKFCFHNPYGAPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELKEALESVTAEQKYLKAR EARHRHSNFTRWQHCVYIEGEVW*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |