Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0535900_circ_g.1 |
| ID in PlantcircBase | osa_circ_028667 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 26617082-26617635 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0535900 |
| Parent gene annotation |
IQ calmodulin-binding region domain containing protein. (Os05t05 35900-01);IQ calmodulin-binding region domain containing protein . (Os05t0535900-02) |
| Parent gene strand | + |
| Alternative splicing | Os05g0535900_circ_g.2 Os05g0535900_circ_g.3 Os05g0535900_circ_g.4 Os05g0535900_circ_g.5 Os05g0535900_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0535900-01:2 Os05t0535900-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.380067817 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26617120-26617400(+) |
| Potential amino acid sequence |
MGKSPAKWIKSVLFGKKSSRSGSTKAKDLSKGSNNKGYAAAGKDAGFESSPVISEPVLVTPHNN EAVQEVGRGENSSLQGEVVVRDVSQDLEKQNTVVSDASNDPERLREEQAAVKAQAAFRGYLAPN PWACGSVGSNGEVSGEVDQIRALREEVIEVRLYQGERFIEGLEQQRVCCCWEGCWV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |