Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0535900_circ_g.1 |
ID in PlantcircBase | osa_circ_028667 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 26617082-26617635 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0535900 |
Parent gene annotation |
IQ calmodulin-binding region domain containing protein. (Os05t05 35900-01);IQ calmodulin-binding region domain containing protein . (Os05t0535900-02) |
Parent gene strand | + |
Alternative splicing | Os05g0535900_circ_g.2 Os05g0535900_circ_g.3 Os05g0535900_circ_g.4 Os05g0535900_circ_g.5 Os05g0535900_circ_g.6 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0535900-01:2 Os05t0535900-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.380067817 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26617120-26617400(+) |
Potential amino acid sequence |
MGKSPAKWIKSVLFGKKSSRSGSTKAKDLSKGSNNKGYAAAGKDAGFESSPVISEPVLVTPHNN EAVQEVGRGENSSLQGEVVVRDVSQDLEKQNTVVSDASNDPERLREEQAAVKAQAAFRGYLAPN PWACGSVGSNGEVSGEVDQIRALREEVIEVRLYQGERFIEGLEQQRVCCCWEGCWV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |