Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa4G192140_circ_g.1 |
| ID in PlantcircBase | csa_circ_002515 |
| Alias | Chr4:9500728_9502631 |
| Organism | Cucumis sativus |
| Position | chrChr4: 9500728-9502631 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | ue-circRNA |
| Identification method | Find_circ |
| Parent gene | Csa4G192140 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Csa4G192140.1:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.127579561 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9502162-9502621(-) |
| Potential amino acid sequence |
MPELRSGARRSRRLDDLQPCTQPLDQGENLAVPAPNRTRRRVAGGRGRGGNAQAVAKGPSVAIP ARPTAARRGRGIRLIDLDPEPCEVLPEAGAIGAAEPVFNRVEAVANKDMAIEGGSADKVMGVEE EAGTAPVPDRVQVGNSPVYKVEKKLGKGGFGQVFVGRRVSGGTDQTGPDAIEVALKFEHHNSKG CSYGPPYEWQVYSALNGCYGIPWVHFKGRQGDFYILVMDMLGPSLWDVWNTLGQSMSPPMVACI AVEAISILEKLHMKGLCL* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | He et al., 2020 |