Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0123500_circ_g.1 |
ID in PlantcircBase | osa_circ_043357 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 1078566-1079239 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRI-long |
Parent gene | Os11g0123500 |
Parent gene annotation |
Snf7 family protein. (Os11t0123500-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os11t0123500-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.150927337 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1078985-1078957(+) 1079043-1079224(-) |
Potential amino acid sequence |
MIQSAKHQRYLWLPLRSQALLSDHELAIGNLLAAQFVFHTASFSLDTELQLVEISRSANWCCKC LLYLPHIFCVFICLFNGIFNVINTH*(+) MLESAKATTDTVDALRSGSSAVKAIHQSVSIDDIENAIEEANEHTENMRQIQEALATPIGASAD FDELQFSV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | this study |