Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0123500_circ_g.1 |
| ID in PlantcircBase | osa_circ_043357 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 1078566-1079239 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRI-long |
| Parent gene | Os11g0123500 |
| Parent gene annotation |
Snf7 family protein. (Os11t0123500-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0123500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.150927337 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1078985-1078957(+) 1079043-1079224(-) |
| Potential amino acid sequence |
MIQSAKHQRYLWLPLRSQALLSDHELAIGNLLAAQFVFHTASFSLDTELQLVEISRSANWCCKC LLYLPHIFCVFICLFNGIFNVINTH*(+) MLESAKATTDTVDALRSGSSAVKAIHQSVSIDDIENAIEEANEHTENMRQIQEALATPIGASAD FDELQFSV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | this study |