Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G44090_circ_g.7 |
| ID in PlantcircBase | ath_circ_042356 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 17747012-17747251 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | AT5G44090 |
| Parent gene annotation |
Calcium-binding EF-hand family protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 13 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G44090.2:1 AT5G44090.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.247039179 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17747019-17747248(+) |
| Potential amino acid sequence |
MSWRFGSLTDFRGDCREGLVFCLEKRGDPGEPRGDSGGVPLFRKTDGNALPQATLRLVQFLDTL TGVLDLVSSIKDLTCGMSWRFGSLTDFRGDCREGLVFCLEKRGDPGEPRGDSGGVPLFRKTDGN ALPQATLRLVQFLDTLTGVLDLVSSIKDLTCGMSWRFGSLTDFRGDCREGLVFCLEKRGDPGEP RGDSGGVPLFRKTDGNALPQATLRLVQFLDTLTGVLDLVSSIKDLTCGMSWRFGSLTDFRGDCR EGLVFCLEKRGDPGEPRGDSGGVPLFRKTDGNALPQATLRLVQFLDTLTGVLDLVSSIKDL(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |