Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0638200_circ_g.1 |
| ID in PlantcircBase | osa_circ_020732 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 24450551-24450837 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0638200 |
| Parent gene annotation |
Similar to Major facilitator superfamily protein, expressed. (Os 03t0638200-01);Similar to Transporter-like protein. (Os03t063820 0-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0638200-01:1 Os03t0638200-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.239840796 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24450582-24450674(+) 24450829-24450600(+) |
| Potential amino acid sequence |
METYTTDEALEFMGFGKFQLLVLAYAGMGWVVESMEIMLLSFVGPLVREEWNISAENESLLSSV VFAGMLIGASGWGFVSDKYGRRLAFTKQTLSTWKHTLRMKRLNSWGLGNSNYLCLHMQAWVGS* (+) MEEDSPLQSRRCQHGNIHYG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |