Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0817900_circ_g.4 |
| ID in PlantcircBase | osa_circ_022458 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 34322456-34322627 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0817900 |
| Parent gene annotation |
Protein of unknown function DUF231, plant domain containing prot ein. (Os03t0817900-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0817900_circ_g.3 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0817900-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.309242248 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34322494-34322500(+) 34322613-34322624(-) 34322549-34322624(-) |
| Potential amino acid sequence |
MDFELSGMDRCRRHTNDTYCPRFRESPTNIMRFPRSISNIRVALKLCSENRKRVKSFHGL*(+) MLEMLRGKRMMFVGDSLNRGQYVSLVCLLHRSIPESSKSMETFDSLTVFRAKL*(-) MCHWCASYTGPSLRAQSPWKLLTRLRFSEQSFNATLMLEMLRGKRMMFVGDSLNRGQYVSLVCL LHRSIPESSKSMETFDSLTVFRAKL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |