Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0623300_circ_g.6 |
| ID in PlantcircBase | osa_circ_025369 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 31671492-31671814 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os04g0623300 |
| Parent gene annotation |
Polyamine oxidase, Seed germination (Os04t0623300-01);Similar to H0215F08.3 protein. (Os04t0623300-02);Similar to H0215F08.3 pro tein. (Os04t0623300-03);Similar to H0215F08.3 protein. (Os04t062 3300-04) |
| Parent gene strand | - |
| Alternative splicing | Os04g0623300_circ_g.2 Os04g0623300_circ_g.3 Os04g0623300_circ_g.4 Os04g0623300_circ_g.5 Os04g0623300_circ_g.7 Os04g0623300_circ_g.8 Os04g0623300_circ_g.9 Os04g0623300_circ_g.10 Os04g0623300_circ_g.11 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0623300-02:2 Os04t0623300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.165634133 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31671740-31671568(+) |
| Potential amino acid sequence |
MPANPLPITIAEGVWDFLLTFSPYEPGCSQINRKAKRVISVNSTTYPVTRF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |