Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0182600_circ_g.12 |
| ID in PlantcircBase | osa_circ_000562 |
| Alias | Os_ciR4253 |
| Organism | Oryza sativa |
| Position | chr1: 4333220-4334031 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0182600 |
| Parent gene annotation |
GIGANTEA protein. (Os01t0182600-01);GIGANTEA protein. (Os01t0182 600-03) |
| Parent gene strand | - |
| Alternative splicing | Os01g0182600_circ_g.6 Os01g0182600_circ_g.7 Os01g0182600_circ_g.8 Os01g0182600_circ_g.9 Os01g0182600_circ_g.10 Os01g0182600_circ_g.11 |
| Support reads | 6/5 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0182600-03:3 Os01t0182600-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.439734945 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4333244-4333937(-) 4333998-4333947(-) |
| Potential amino acid sequence |
MYHRTKGSLQPRIWEAPTTYAIHAQMGCCQWSWSYTKCL*(-) MPSTPRWAVANGAGVILSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAGLPPLEPYA RLFHRYYAIATPSATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYDSGMRLPKNWMHLH FLRAIGTAMSMRAGIAADTSAALLFRILSQPTLLFPPLRHAEGVELHHEPLGGYVSSYKRQLTA EDLGSTHNLCHPRPDGLLPMELELY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |