Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d014500_circ_g.1 |
ID in PlantcircBase | zma_circ_008480 |
Alias | zma_circ_0002106 |
Organism | Zea mays |
Position | chr5: 50458564-50461153 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d014500 |
Parent gene annotation |
Structural maintenance of chromosomes protein 5 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d014500_T015:7 Zm00001d014500_T008:7 Zm00001d014500_T017:7 Zm00001d014500_T013:7 Zm00001d014500_T014:7 Zm00001d014500_T004:7 Zm00001d014500_T023:7 Zm00001d014500_T005:7 Zm00001d014500_T003:7 Zm00001d014500_T021:7 Zm00001d014500_T002:7 Zm00001d014500_T009:7 Zm00001d014500_T024:7 Zm00001d014500_T001:7 Zm00001d014500_T020:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.018893645 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
50461111-50458883(+) 50461145-50461151(-) |
Potential amino acid sequence |
MLGVAYYSCFPFPSTNTSLYLFSCLLVVSHRINNFFLLPVYICLFVF*(+) MESKNSKLLQALRSAGADKIIEAYHWVQANKKNLRQEVYGPVLLEVNVQDKLHATYLEDHVPNY LWKSFITLDASDRDYIAREMKQYGIPVLNYLVREGTRRRPLNITPEMEQLGIYSRLDQVFQAPD TVKDVLISQAGLDDSYIGTDETHRRADEVSKLGIYDFWTPDNHYRWSKSRYSGYMSAFVDAIHP SRLFKSNLDVSGIEDLRLQKEDHVTNIEGMREAIKTLHRKQRQLEDEEANIHRQKEEIINAMRY HKKTREEIQRRVG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |