Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d014500_circ_g.1 |
| ID in PlantcircBase | zma_circ_008480 |
| Alias | zma_circ_0002106 |
| Organism | Zea mays |
| Position | chr5: 50458564-50461153 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d014500 |
| Parent gene annotation |
Structural maintenance of chromosomes protein 5 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d014500_T015:7 Zm00001d014500_T008:7 Zm00001d014500_T017:7 Zm00001d014500_T013:7 Zm00001d014500_T014:7 Zm00001d014500_T004:7 Zm00001d014500_T023:7 Zm00001d014500_T005:7 Zm00001d014500_T003:7 Zm00001d014500_T021:7 Zm00001d014500_T002:7 Zm00001d014500_T009:7 Zm00001d014500_T024:7 Zm00001d014500_T001:7 Zm00001d014500_T020:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.018893645 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
50461111-50458883(+) 50461145-50461151(-) |
| Potential amino acid sequence |
MLGVAYYSCFPFPSTNTSLYLFSCLLVVSHRINNFFLLPVYICLFVF*(+) MESKNSKLLQALRSAGADKIIEAYHWVQANKKNLRQEVYGPVLLEVNVQDKLHATYLEDHVPNY LWKSFITLDASDRDYIAREMKQYGIPVLNYLVREGTRRRPLNITPEMEQLGIYSRLDQVFQAPD TVKDVLISQAGLDDSYIGTDETHRRADEVSKLGIYDFWTPDNHYRWSKSRYSGYMSAFVDAIHP SRLFKSNLDVSGIEDLRLQKEDHVTNIEGMREAIKTLHRKQRQLEDEEANIHRQKEEIINAMRY HKKTREEIQRRVG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |