Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | POPTR_0008s08480_circ_g.1 |
| ID in PlantcircBase | pop_circ_002332 |
| Alias | Chr08:5351864-5352303 |
| Organism | Populus trichocarpa |
| Position | chr8: 5259424-5259863 JBrowse» |
| Reference genome | Populus trichocarpa genome v3.0 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | POPTR_0008s08480 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | stem xylem |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | POPTR_0008s08480.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.202715284 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5259848-5259466(+) 5259862-5259856(-) 5259432-5259801(-) |
| Potential amino acid sequence |
MSTSIPLHCHEPPNQGNIDM*(+) MLVDMTLQFQRLVPVIVSYTDRLLGCQKHRWLGERLLQTVDELLLPKVKINYKLSSYLPIFDRI AENSTIPPRGLLDLLDKFMVFLVEKHGPDTGLKTWSRGSKVLGICRTMLMHHHSSRLFLGLSRL LAFTCLYFPDLEVRDNARGC*(-) MQGDASGHDIAVSEIGPCHCFLH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Liu et al., 2021 |