Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d029165_circ_g.1 |
ID in PlantcircBase | zma_circ_006530 |
Alias | zma_circ_0000681 |
Organism | Zea mays |
Position | chr1: 60879838-60880312 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d029165 |
Parent gene annotation |
Tubby protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d029165_T001:1 Zm00001d029165_T002:1 Zm00001d029165_T004:1 Zm00001d029165_T005:1 Zm00001d029165_T003:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.415054404 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
60880278-60880140(+) |
Potential amino acid sequence |
MESITQFILLGPLASFAGNFCIKTAQTNCKSLKCRYWITVVHGEQVFSDLSELENHLVTLLVLW SIVLRSHQLEVFNRGNSDPPTEIQAPTLQLFVPPRRLVLKHQPIFPLTG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |